Etheostoma cragini (Arkansas darter): 117950783 Help Entry 117950783         CDS       T07493                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism ecra  Etheostoma cragini (Arkansas darter) Brite KEGG Orthology (KO) [BR:ecra00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ecra03036]     117950783   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecra04147]     117950783 Chromosome and associated proteins [BR:ecra03036]  Eukaryotic type   Nucleosome assembly factors    Histones     117950783 Exosome [BR:ecra04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117950783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  117950783 NCBI-ProteinID:  XP_034738013 LinkDB All DBs Position 9:550260..550572 Genome browser AA seq 79 aa AA seqDB search STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMSLQESSEAYLVGLFEDTNLCAIHAKR VTIMPKDIQLARRIRGERA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt tccaccgagctgctgatccgcaagctgcccttccagcgcctggtccgcgagatcgcccag gacttcaagaccgacctccgcttccagagctccgccgtcatgtccctgcaggagtccagc gaggcctacctggtcggcctgttcgaggacaccaacctgtgcgccatccacgccaagagg gtcaccatcatgcccaaagacatccagctggcccggcgtatccgcggagagagggcttag

DBGET integrated database retrieval system