Etheostoma cragini (Arkansas darter): 117960360 Help Entry 117960360         CDS       T07493                                  Symbol borcs7 Name (RefSeq) BLOC-1-related complex subunit 7   KO K20821   BLOC-1 related complex subunit 7 Organism ecra  Etheostoma cragini (Arkansas darter) Pathway ecra04142   Lysosome biogenesis Brite KEGG Orthology (KO) [BR:ecra00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome biogenesis     117960360 (borcs7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecra04131]     117960360 (borcs7) Membrane trafficking [BR:ecra04131]  Endosome - Lysosome transport   Arf GTPases and associated proteins    BLOC-one-related complex (BORC)     117960360 (borcs7) SSDB OrthologParalogGFIT Motif Pfam:  BORCS7 Motif Other DBs NCBI-GeneID:  117960360 NCBI-ProteinID:  XP_034754093 LinkDB All DBs Position 17:complement(24376494..24382298) Genome browser AA seq 103 aa AA seqDB search MASAESQPRFGQSVKGLLSDKVGSCSGDVIALTRQVLKGSRSQELLGQAARNMVIQEDAI LHSEDSLRKMSIITTHLQYQQEAIQKNVEHSKNLQDQLRHLLK NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcgtcagctgagtcccagccgcggtttggccagtctgtcaaaggcttactatccgat aaagtgggctcctgtagcggggatgtgatcgcactgacccgtcaagtgctgaagggatcg cggagtcaggagctccttggtcaagcagcgagaaatatggtcattcaggaggacgccatc ctgcattctgaggatagtctcagaaagatgtccatcatcaccacacatttacagtaccag caggaggccatccagaagaatgtggagcactctaaaaacctccaggaccagctgagacac ctgctaaagtga

DBGET integrated database retrieval system