KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_1470
Entry
ECs_1470          CDS       T00048                                 
Symbol
fabD
Name
(RefSeq) malonyl-CoA-[acyl-carrier-protein] transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00061  Fatty acid biosynthesis
ecs00074  Mycolic acid biosynthesis
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01212  Fatty acid metabolism
Module
ecs_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECs_1470 (fabD)
   00074 Mycolic acid biosynthesis
    ECs_1470 (fabD)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ECs_1470 (fabD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecs01004]
    ECs_1470 (fabD)
Enzymes [BR:ecs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     ECs_1470 (fabD)
Lipid biosynthesis proteins [BR:ecs01004]
 Fatty acid synthase
  Component type
   ECs_1470 (fabD)
SSDB
Motif
Pfam: Acyl_transf_1
Other DBs
NCBI-GeneID: 913863
NCBI-ProteinID: NP_309497
UniProt: Q8X8I7
LinkDB
Position
1508964..1509893
AA seq 309 aa
MTQFAFVFPGQGSQTVGMLADMAASYPIVEETFAEASAALGYDLWALTQQGPAEELNKTW
QTQPALLTASVALYRVWQQHGGKAPAMMAGHSLGEYSALVCAGVIDFADAVRLVEMRGKF
MQEAVPEGTGAMAAIIGLDDASIGKACEEAAEGQVVSPVNFNSPGQVVIAGHKEAVERAG
AACKAAGAKRALPLPVSVPSHCALMKPAADKLAVELAKITFNAPTVPVVNNVDVKCETNG
DAIRDALVRQLYNPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRIVDTLTASALNEP
SAMAAALEL
NT seq 930 nt   +upstreamnt  +downstreamnt
atgacgcaatttgcatttgtgttccctggacagggttctcaaaccgttggaatgctggct
gatatggcggcgagctatccaattgtcgaagaaacgtttgctgaagcttctgcggcgctg
ggctacgacctgtgggcgctgacccagcaggggccagctgaagaactgaataaaacctgg
caaacccagccagcgctgttgactgcctctgttgcgctgtaccgcgtatggcagcagcat
ggcggtaaagcaccggcaatgatggccggtcacagcctgggggaatactccgcgctggtt
tgcgctggtgtgattgatttcgctgatgcggtgcgtctggttgagatgcgcggcaagttc
atgcaagaagccgtaccggaaggaacgggcgctatggcggcaatcatcggtctggatgat
gcgtctattggaaaagcgtgtgaagaagctgcagaaggtcaggtcgtttctccggtaaac
tttaactctccgggacaggtggttattgccggtcataaagaagcggttgagcgtgctggc
gctgcctgtaaagctgcgggcgcaaaacgcgctctgccgttaccagtgagcgtaccgtct
cactgtgcgctgatgaaaccagcagccgacaaactggcagtagaattagcgaaaatcacc
tttaacgcaccaacagttcctgttgtgaataacgttgatgtgaaatgcgaaaccaatggt
gatgccattcgtgacgcactggtacgtcagttgtataacccggttcagtggacgaagtct
gttgagtacatggcagcgcaaggcgtagaacatctctatgaagtcggcccgggcaaagtg
cttactggcctgacgaaacgcattgtcgacaccctgaccgcctcggcgctgaacgaacct
tcagcgatggcagcggcgctcgagctttaa

DBGET integrated database retrieval system