Escherichia coli O157 H7 Sakai (EHEC): ECs_2218 Help Entry ECs_2218          CDS       T00048                                  Name (RefSeq) DNA damage-inducible protein   KO K12149   DNA-damage-inducible protein I Organism ecs  Escherichia coli O157:H7 Sakai (EHEC) Brite KEGG Orthology (KO) [BR:ecs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ecs03400]     ECs_2218 DNA repair and recombination proteins [BR:ecs03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     ECs_2218 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-GeneID:  917424 NCBI-ProteinID:  NP_310245 UniProt:  A0A0H3JJU4 LinkDB All DBs Position 2204156..2204410 Genome browser AA seq 84 aa AA seqDB search MVVFFLKIPNLDFAVYLRPFYVPYMPHRYPAAKINKMPKGSVPALQQEMLRRVSKRYDDV EVIIKSTSNDGLEPPRFSWRVFYL NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggttgtattttttctaaaaatccctaatctcgattttgctgtttatttgaggcctttt tatgtcccatatatgccccacagataccccgcagccaaaatcaacaaaatgccaaaaggt tctgttcctgccctgcaacaagaaatgctgcgacgtgtcagtaaacgttatgacgatgta gaagtgatcatcaaatccaccagcaacgatggccttgaaccgccccggttttcctggaga gtgttttatctgtga

DBGET integrated database retrieval system