Escherichia coli O157 H7 Sakai (EHEC): ECs_4328 Help Entry ECs_4328          CDS       T00048                                  Name (RefSeq) acyl carrier protein   KO K02078   acyl carrier protein Organism ecs  Escherichia coli O157:H7 Sakai (EHEC) Pathway ecs01100   Metabolic pathways ecs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECs_4328    00074 Mycolic acid biosynthesis     ECs_4328   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECs_4328 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-GeneID:  916270 NCBI-ProteinID:  NP_312355 UniProt:  Q8X6N5 LinkDB All DBs Position 4335741..4335998 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLDELTPDDIDTDAPLFGDGLGLDSIDALELGLAVKNEYGIVLS AESEEMRQHFFSVATLASFIAAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatctggaaattaaaaacctcatcatcagcaccctcaatctggacgag ttgacgcctgatgatatcgataccgacgcgccgctgtttggcgacggtttagggctggac tctatcgatgccctggaactgggactggcagtaaaaaatgagtacggcatcgtgctctct gcggaaagcgaagagatgcgtcagcactttttctccgtcgccactctggcctctttcatt gctgcgcaacgtgcctga

DBGET integrated database retrieval system