KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_4554
Entry
ECs_4554          CDS       T00048                                 
Symbol
espB
Name
(RefSeq) T3SS translocator EspB
  KO
K23650  LEE-encoded effector EspB
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_4554 (espB)
SSDB
Motif
Pfam: EspB DUF4064
Other DBs
NCBI-GeneID: 915476
NCBI-ProteinID: NP_312581
UniProt: Q8XC86
LinkDB
Position
complement(4591168..4592106)
AA seq 312 aa
MNTIDNTQVTMVNSASESTTGASSAVAASALSIDSSLLTDGKVDICKLMLEIQKLLGKMV
TLLQDYQQKQLAQSYQIQQAVFESQNKAIEEKKAAATAALVGGIISSALGILGSFAAMNN
AAKGAGEIAEKASSASSKAAGAASEVANKALVKATESVADVAEEASSAMQKAMATTTKAA
SRASGVADDVAKASDFAEDLADAAEKTSRINKLLNSVDKLTNTTAFVAVTSLAEGTKTLP
TTISESVKSTHEVNEQRAKSLENFQQGNLELYKQDVRRTQDDITTRLRDITSAVRDLLEV
QNRMGQSGRLAG
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaatactattgataatactcaagtaacgatggttaattccgcttcggagagtacgacc
ggcgcttccagtgcagttgccgcatctgctttatcaattgattcatctctgcttactgat
ggtaaggttgatatttgtaagctgatgctggaaattcaaaaactcctcggcaagatggtg
actctattgcaggattaccaacaaaaacaattggcgcaaagctatcagattcagcaggcc
gtttttgagagccagaataaagctattgaggaaaaaaaagccgcggcaaccgctgctttg
gttggcgggattatttcatcagcattggggatcttaggttcttttgcagcaatgaacaac
gcggctaaaggggctggtgagattgctgaaaaagcaagctctgcatcttcaaaggctgct
ggtgcggcttctgaggttgcaaataaagctctggtcaaggctacggaaagtgttgctgat
gtcgcagaggaggcatccagtgcgatgcagaaagcgatggccacaacaacgaaagcagcc
agccgtgcatctggcgttgcagatgatgttgcgaaagcctctgactttgctgaagatctt
gcagacgccgccgagaagacaagcagaatcaataagttgttgaattccgtagataaactg
accaataccacagcatttgttgccgtgaccagtcttgctgaaggtacgaaaacgttgcca
acaacaatatctgagtccgtcaaatcgactcatgaggttaatgaacaacgtgcgaagtcg
ctggaaaacttccagcaggggaatctggagctgtataaacaagacgttcgcagaacgcag
gatgatatcacgactcgtctgcgtgatataacgtccgctgtccgcgatctccttgaggtc
cagaatcgtatggggcaatcgggtcgcttagctgggtaa

DBGET integrated database retrieval system