Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3472 Help Entry ECIAI39_3472      CDS       T00829                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism ect  Escherichia coli O7:K1 IAI39 (ExPEC) Pathway ect01100   Metabolic pathways ect01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ect00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECIAI39_3472    00074 Mycolic acid biosynthesis     ECIAI39_3472   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECIAI39_3472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  CAR19589 UniProt:  A0A0H3MKY1 LinkDB All DBs Position 3630830..3631078 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system