Ectobacillus sp. JY-23: MUG87_02105 Help Entry MUG87_02105       CDS       T09162                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ecto  Ectobacillus sp. JY-23 Brite KEGG Orthology (KO) [BR:ecto00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ecto03032]     MUG87_02105    03036 Chromosome and associated proteins [BR:ecto03036]     MUG87_02105    03400 DNA repair and recombination proteins [BR:ecto03400]     MUG87_02105 DNA replication proteins [BR:ecto03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MUG87_02105 Chromosome and associated proteins [BR:ecto03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MUG87_02105 DNA repair and recombination proteins [BR:ecto03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MUG87_02105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_2 HU-CCDC81_euk_1 HATPase_c_2 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  UOY92954 LinkDB All DBs Position 386268..386540 Genome browser AA seq 90 aa AA seqDB search MNKTELVKQVAAKAELSQKDASAAVNAVFEAVTNALAQGEKVQLIGFGTFEVRERAARTG RNPQTGAEITIAATKAPAFKAGKELKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattagtaaaacaagtagcagcaaaagctgaactatctcaaaaagat gcgtctgcagctgtaaatgctgtatttgaagcagtgacaaacgcattggcacaaggagaa aaggtacagttgattggtttcggaacttttgaagttcgcgaacgtgcagctcgtacaggc cgcaacccacaaacgggcgcagagattacaattgctgcgacaaaagcaccagcatttaaa gcgggaaaagagcttaaagaagcggtaaaataa

DBGET integrated database retrieval system