Encephalitozoon cuniculi: ECU03_0300
Help
Entry
ECU03_0300 CDS
T00105
Name
(RefSeq) SCF ubiquitin ligase subunit SKP1
KO
K03094
S-phase kinase-associated protein 1
Organism
ecu
Encephalitozoon cuniculi
Pathway
ecu03083
Polycomb repressive complex
ecu04111
Cell cycle - yeast
ecu04120
Ubiquitin mediated proteolysis
ecu04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
ecu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
ECU03_0300
04120 Ubiquitin mediated proteolysis
ECU03_0300
09126 Chromosome
03083 Polycomb repressive complex
ECU03_0300
09140 Cellular Processes
09143 Cell growth and death
04111 Cell cycle - yeast
ECU03_0300
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ecu04131
]
ECU03_0300
04121 Ubiquitin system [BR:
ecu04121
]
ECU03_0300
03036 Chromosome and associated proteins [BR:
ecu03036
]
ECU03_0300
Membrane trafficking [BR:
ecu04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
ECU03_0300
Ubiquitin system [BR:
ecu04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
ECU03_0300
Cul7 complex
ECU03_0300
Chromosome and associated proteins [BR:
ecu03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
ECU03_0300
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
ECU03_0300
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
mTOR_dom
Motif
Other DBs
NCBI-GeneID:
858703
NCBI-ProteinID:
NP_597541
UniProt:
Q8SW66
LinkDB
All DBs
Position
III:complement(38997..39455)
Genome browser
AA seq
152 aa
AA seq
DB search
MIEIETIDGHIFRLEENEAYKSILIRNVCTSTACRYPIALRVRSSIFMIIQKYMKVDTSQ
LSEDYNPLEIRFKPSDFSFFMEYDNKTLLDICNGANYLEYPYLLELCCKIISEKMKSKST
RELAEFIGMECNMTEEEMRRVEKEFEWVSSEE
NT seq
459 nt
NT seq
+upstream
nt +downstream
nt
atgatcgagatagaaacaatagacggacatatatttaggctggaggaaaatgaggcatac
aagagcattctgataagaaacgtgtgtacatcaacggcatgcaggtatcccattgctctt
agagtacgatcttcgatcttcatgataatacaaaaatatatgaaggtagacacctctcag
ttgtctgaagactataacccattggaaataagattcaagccatcggacttcagttttttc
atggaatatgacaacaagacattgctggacatatgcaatggagccaactaccttgagtac
ccgtacttacttgagctgtgctgcaaaattatctctgaaaagatgaagagcaagagtaca
agggagcttgcagagtttatcggaatggagtgcaatatgactgaggaagagatgaggaga
gtcgaaaaggagttcgaatgggtatcttctgaagaatag
DBGET
integrated database retrieval system