Encephalitozoon cuniculi: ECU03_1560 Help Entry ECU03_1560        CDS       T00105                                  Name (RefSeq) Rho-like GTPase   KO K04393   cell division control protein 42 Organism ecu  Encephalitozoon cuniculi Pathway ecu04011   MAPK signaling pathway - yeast ecu04144   Endocytosis ecu04517   IgSF CAM signaling ecu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ecu00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     ECU03_1560   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     ECU03_1560    04518 Integrin signaling     ECU03_1560  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     ECU03_1560  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     ECU03_1560  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecu04131]     ECU03_1560    03036 Chromosome and associated proteins [BR:ecu03036]     ECU03_1560   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecu04147]     ECU03_1560    04031 GTP-binding proteins [BR:ecu04031]     ECU03_1560 Membrane trafficking [BR:ecu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     ECU03_1560  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     ECU03_1560   Macropinocytosis    Ras GTPases     ECU03_1560 Chromosome and associated proteins [BR:ecu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     ECU03_1560 Exosome [BR:ecu04147]  Exosomal proteins   Exosomal proteins of microglial cells    ECU03_1560   Exosomal proteins of breast milk    ECU03_1560 GTP-binding proteins [BR:ecu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     ECU03_1560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU MMR_HSR1 Arf AAA_7 Motif Other DBs NCBI-GeneID:  858826 NCBI-ProteinID:  NP_597664 UniProt:  Q8SVZ2 LinkDB All DBs Position III:186117..186656 Genome browser AA seq 179 aa AA seqDB search METIKCVLVGDPSVGKSWLISTYITGRNPEGYIPTLFNNYSKVVNMGDKKYNMTLWDTAG SEEYNKLRNLSFQETDVFLVCYAVNNILSFHNTRRWVEELARYNVPMILCGTKCDIIDGN IVDKELPVQLSKEYGLYGSMECSSVELINVKKVFDIALEAALKPRKSKFRSIWFCCKCG NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atggagacgatcaagtgcgttcttgtgggggatccatcagtggggaagagctggctgata agcacctacataacgggcaggaatcctgagggctacatcccaacactcttcaacaactac agcaaggtcgttaacatgggggacaaaaagtacaatatgacgctatgggatacagccggg agcgaggagtataataagttaaggaacttgtcgttccaagaaacggatgtttttttggtg tgctatgcagttaacaacattctttcgttccataacacgaggagatgggtagaagagctt gcaaggtacaacgtccccatgatcctgtgcgggactaaatgcgatataattgatggaaat attgtagacaaagagctgcctgtacaactaagcaaggaatacgggctttatggatccatg gaatgctcctcggtagaacttataaacgtaaaaaaggtcttcgacatagctctcgaagca gctctgaaacctcggaaaagtaagtttagatcgatctggttctgctgcaagtgtggatag

DBGET integrated database retrieval system