Encephalitozoon cuniculi: ECU08_0320 Help Entry ECU08_0320        CDS       T00105                                  Name (RefSeq) uncharacterized protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism ecu  Encephalitozoon cuniculi Pathway ecu03020   RNA polymerase ecu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ecu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     ECU08_0320   09124 Replication and repair    03420 Nucleotide excision repair     ECU08_0320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ecu03021]     ECU08_0320    03400 DNA repair and recombination proteins [BR:ecu03400]     ECU08_0320 Transcription machinery [BR:ecu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      ECU08_0320   RNA polymerase III system    RNA polymerase III      ECU08_0320   RNA polymerase I system    RNA polymerase I      ECU08_0320 DNA repair and recombination proteins [BR:ecu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       ECU08_0320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 CvfB_2nd Motif Other DBs NCBI-GeneID:  859583 NCBI-ProteinID:  NP_597161 UniProt:  Q8SRE9 LinkDB All DBs Position VIII:43502..43852 Genome browser AA seq 116 aa AA seqDB search MDKEDVDSVNEYSTEEINMEVLEISDAGMKIKASERKTLPRMTKYEKAHVIGVRATQLSA GAPPFVDIGNETNPLNIANMELSEKKIPFIIRRKLPDSSFEDWAVDELMIPGVDFQ NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacaaagaggatgtcgattctgtgaacgagtattccacagaggaaatcaacatggaa gttcttgaaatctctgatgcaggtatgaagatcaaggcctcggagcggaaaacacttcct agaatgaccaaatatgaaaaagcgcatgtgatcggtgttcgtgcaactcagctaagtgca ggcgcacccccgtttgtagacataggaaacgaaaccaacccgcttaacattgcaaacatg gagctgagcgaaaaaaaaattccgttcatcatccggagaaagcttccagacagcagcttt gaagactgggccgttgatgagctgatgatccctggtgtagactttcagtag

DBGET integrated database retrieval system