Encephalitozoon cuniculi: ECU10_1045 Help Entry ECU10_1045        CDS       T00105                                  Name (RefSeq) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism ecu  Encephalitozoon cuniculi Pathway ecu03020   RNA polymerase ecu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ecu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     ECU10_1045   09124 Replication and repair    03420 Nucleotide excision repair     ECU10_1045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ecu03021]     ECU10_1045    03400 DNA repair and recombination proteins [BR:ecu03400]     ECU10_1045 Transcription machinery [BR:ecu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      ECU10_1045   RNA polymerase III system    RNA polymerase III      ECU10_1045   RNA polymerase I system    RNA polymerase I      ECU10_1045 DNA repair and recombination proteins [BR:ecu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       ECU10_1045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD DUF5816 MCM_OB NCD3G Zn_ribbon_SprT zf-C2HE Motif Other DBs NCBI-GeneID:  77136426 NCBI-ProteinID:  NP_001402545 LinkDB All DBs Position X:140750..140905 Genome browser AA seq 51 aa AA seqDB search MDQEQKVFTYVCIQCPSLRELKLKDPIRCTECGNRVLRKKRTDEVVQLDAV NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggaccaagagcagaaggtctttacatatgtatgcatacaatgcccgtccctgagggag ctaaaactcaaggatcccatcaggtgcacggagtgtggaaacagggttcttcggaagaaa aggactgacgaggtggtgcagctggatgccgtctaa

DBGET integrated database retrieval system