Escherichia coli APEC O1 (APEC): APECO1_4315
Help
Entry
APECO1_4315 CDS
T00425
Symbol
yfaV
Name
(GenBank) conserved hypothetical protein
KO
K26580
MFS transporter, ACS family, inner membrane transport protein
Organism
ecv
Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:
ecv00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ecv02000
]
APECO1_4315 (yfaV)
Transporters [BR:
ecv02000
]
Major facilitator superfamily (MFS)
Organic acid transporters
Anion:cation symporter (ACS) family [TC:
2.A.1.14
]
APECO1_4315 (yfaV)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
Imm21
Motif
Other DBs
NCBI-ProteinID:
ABJ01638
UniProt:
A0A0H2Z0Q0
LinkDB
All DBs
Position
complement(2467573..2468901)
Genome browser
AA seq
442 aa
AA seq
DB search
MTTVTPTYSKELFMSTALLDAVVKKNRARLIPFMLALYVLAFLDRSNIGFAKQTYQIDTG
LSNEAYALGAGIFFVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKF
LIVRTLLGAAEAGFFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMH
GFMGHPGWFWMFVIEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKV
TSRLSDALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVA
ALFGTWLIPRYSDKTGERRNVAALTLLAAGIGIGLSGLLSPVLAIVALCVAAIGFIAVQP
VFWTMPTQLLSGTALAAGIGFINLFGAVGGFIAPILRVKAETLFSSDAAGLLTLAAVAVI
GSLIIFTLRVNRTVAQTDVAHH
NT seq
1329 nt
NT seq
+upstream
nt +downstream
nt
gtgacaacggtaacgcccacatattctaaggagctttttatgagcaccgctttgcttgac
gccgtggtgaagaaaaaccgcgcgcgtttaattccgtttatgttggcgctgtatgtgctg
gcgtttctcgaccgttcgaatattggttttgccaaacagacctaccagattgataccggg
ctgagtaatgaagcttatgcgctgggagcaggcattttctttgtggtatacgcgtttctg
ggggttccggcgaatcttttgatgcgcaaactgggggccagaacctggattggtacgaca
acactgctgtggggatttctttcggctgccatggcatgggccgatactgaagcgaaattt
ctgatcgttcgcactctgcttggtgctgcggaggccgggtttttccctggtatgatttat
ctcacttcgcaatggtttccgcagcgtaatcgcgccagcattatggggctgttctatatg
ggcgcaccgctggcgttaacactgggatcaccgctttccggcgcgctgctggagatgcat
ggatttatggggcatcccggctggttctggatgtttgtgattgaaggattgctggcagtc
ggcgctggggtattcacattcttttggcttgatgacacaccggagcaggcacgttttctg
agtaaacaagaaaaaacgttacttatcaatcaactggcaagtgaagaacaacagaaagtg
acttcgcgactgagcgatgcgttgcgtaatggccgagtctggcaactggcgattatctac
ctgaccattcaggtagcggtttacggattaattttcttcctgccgacccaggttgcggca
ttgctgggaacaaaagtgggctttacggcgtcggtggtcaccgccattccgtgggttgcg
gccttgtttgggacctggcttattccgcgctactccgataaaaccggcgaacggcgtaat
gtcgcagcgctgacattactggcggcgggcattggtattggtctgtccgggctgctttct
ccagtactggcgatcgtagcactgtgtgttgcagccatcgggtttattgccgtgcaaccg
gtgttctggacgatgccgacacagcttctttccggtacggcgctggctgcggggattggt
tttataaacctgtttggtgcagtgggcgggtttattgccccgatcctgcgcgtgaaagca
gaaacgttattttccagcgatgcggcgggattactgacgctggcagcggtggcggtcatc
ggttcgctgattattttcactctgcgtgtaaatcgcactgttgcgcagaccgacgtggca
catcattaa
DBGET
integrated database retrieval system