Escherichia coli O9 HS (commensal): EcHS_A1262 Help Entry EcHS_A1262        CDS       T00591                                  Name (GenBank) conserved hypothetical protein   KO K21976   probable RcsB/C two-component-system connector, global regulator of biofilm formation and acid-resistance Organism ecx  Escherichia coli O9 HS (commensal) Brite KEGG Orthology (KO) [BR:ecx00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99995 Signaling proteins     EcHS_A1262 SSDB OrthologParalogGFIT Motif Pfam:  YmgB Motif Other DBs NCBI-ProteinID:  ABV05601 UniProt:  A7ZZ97 LinkDB All DBs Position 1264818..1265084 Genome browser AA seq 88 aa AA seqDB search MLEDTTIHNAITDKALASYFRSSGNLLEEESAVLGQAVTNLMLSGDNVNNKNIILSLIHS LETTSDILKADVIRKTLEIVLRYTADDM NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcttgaagatactacaattcataatgcaataactgataaagcgttagcaagttacttt cgcagttcgggtaatttgttagaagaagagtcagcagtgttagggcaggctgtcaccaat ttaatgctttcaggcgataatgttaataataaaaatattatcttaagtctgatacactcc ctggaaacaacaagtgatattctcaaagctgatgtgattagaaaaacactggaaatcgtg ttgcgatacacagctgatgatatgtaa

DBGET integrated database retrieval system