Escherichia coli O9 HS (commensal): EcHS_A3157 Help Entry EcHS_A3157        CDS       T00591                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ecx  Escherichia coli O9 HS (commensal) Pathway ecx01100   Metabolic pathways ecx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EcHS_A3157    00074 Mycolic acid biosynthesis     EcHS_A3157   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EcHS_A3157 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  ABV07392 UniProt:  A0A7I6H4G0 LinkDB All DBs Position 3170860..3171108 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system