Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_3359 Help Entry ECS88_3359        CDS       T00830                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism ecz  Escherichia coli O45:K1:H7 S88 (ExPEC) Pathway ecz01100   Metabolic pathways ecz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECS88_3359    00074 Mycolic acid biosynthesis     ECS88_3359   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECS88_3359 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  CAR04591 UniProt:  B7MA42 LinkDB All DBs Position 3324542..3324790 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataactaa

DBGET integrated database retrieval system