Edaphobacter sp. 12200R-103: GWR55_07825 Help Entry GWR55_07825       CDS       T06408                                  Name (GenBank) glutaredoxin family protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism eda  Edaphobacter sp. 12200R-103 Brite KEGG Orthology (KO) [BR:eda00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     GWR55_07825 Enzymes [BR:eda01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      GWR55_07825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_9 SH3BGR YfjL_C Motif Other DBs NCBI-ProteinID:  QHS51659 UniProt:  A0A6B9YPT6 LinkDB All DBs Position 1894502..1894759 Genome browser AA seq 85 aa AA seqDB search MDLTVYTAAWCRDCREAKRFLDQHNIPYKEVDIEVTPGAAELVLENVGKRAIPQFVIDGR WVQPYRPGRGFLHEEMADLLGVTGS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggatctgaccgtctacaccgcggcctggtgccgcgactgccgggaggcgaagcgcttc ctggaccagcacaatattccctacaaagaagtggatatcgaagtcacgccaggcgccgcc gaactcgtcctcgaaaacgtcgggaaacgcgcgattccccagttcgtcatcgatggaaga tgggtccagccctacaggccgggacgcggcttcctccatgaggagatggctgacctcctt ggcgtcacagggagctaa

DBGET integrated database retrieval system