Edaphobacter sp. 12200R-103: GWR55_14690 Help Entry GWR55_14690       CDS       T06408                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eda  Edaphobacter sp. 12200R-103 Pathway eda01100   Metabolic pathways eda01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eda00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GWR55_14690    00074 Mycolic acid biosynthesis     GWR55_14690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GWR55_14690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QHS52828 UniProt:  A0A6B9YST9 LinkDB All DBs Position complement(3534234..3534476) Genome browser AA seq 80 aa AA seqDB search MAAVDEKVKQIIVEQLQVDEAEVTPGASFQEDLGADSLDVVELVMQFEEAFDIQIPDEDA EKIKTVKDAIEYIEKNQKAK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcagcagttgatgaaaaggtgaagcagattattgtcgagcagcttcaggtcgatgag gccgaagtgacccccggcgcaagctttcaggaggatcttggcgccgactctctcgacgta gtcgagctcgtcatgcagttcgaagaggccttcgacatccagattcccgatgaggatgcg gagaagatcaagaccgtcaaagatgccattgaatacatcgagaagaaccagaaggcgaag taa

DBGET integrated database retrieval system