Edaphobacter albus: H7846_00020 Help Entry H7846_00020       CDS       T08591                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism edg  Edaphobacter albus Pathway edg01100   Metabolic pathways edg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:edg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H7846_00020    00074 Mycolic acid biosynthesis     H7846_00020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H7846_00020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QNI36777 LinkDB All DBs Position complement(2326..2568) Genome browser AA seq 80 aa AA seqDB search MAAVDEKVKQIIVEQLQVDEAEVTPGASFQEDLGADSLDVVELVMQFEEAFDIQIPDEDA EKIKTVKDAIEYIEKNQKAK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcagcagttgatgaaaaggtaaaacagattattgtcgagcagcttcaggtggatgag gccgaagtgaccccgggagctagcttccaggaggaccttggtgccgactcgctcgacgta gtcgagctcgtcatgcagttcgaagaagccttcgacatccagattcccgatgaggatgcc gagaagatcaagaccgtcaaagacgcgattgagtacatcgagaagaaccagaaggcgaag taa

DBGET integrated database retrieval system