Edaphobacter sp. 4G125: H7846_09130 Help Entry H7846_09130       CDS       T08591                                  Name (GenBank) flagellar hook capping protein   KO K02389   flagellar basal-body rod modification protein FlgD Organism edg  Edaphobacter sp. 4G125 Pathway edg02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:edg00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     H7846_09130  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:edg02035]     H7846_09130 Bacterial motility proteins [BR:edg02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     H7846_09130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgD Motif Other DBs NCBI-ProteinID:  QNI35271 UniProt:  A0A7G8BRV1 LinkDB All DBs Position 2184202..2184525 Genome browser AA seq 107 aa AA seqDB search MDLSQLNSFTDHEGAANRVASALVPRAQTTTTKDTTGNGIGSPSTDNSTITANDFLTLLV TELKNQDPTQPTDPNAYIQQLVGVNSLQQLIEINKGIGSLNSTVTGE NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggatttatcacaacttaattcgtttacggaccatgagggggcggcaaatcgcgttgct tccgcgctggttccaagggcgcaaacaacgactacgaaggatacaaccggcaatggaatc gggagtccttcgacggataactcaaccattacggcgaatgattttctgacgcttcttgtt accgagctgaagaaccaggacccgacacagccgactgatccgaatgcttatatccagcag cttgttggagtgaatagtctgcaacagctgattgagatcaataagggaattggatcgctg aatagcactgtaaccggcgaataa

DBGET integrated database retrieval system