Edaphobacter albus: H7846_16785 Help Entry H7846_16785       CDS       T08591                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism edg  Edaphobacter albus Pathway edg01100   Metabolic pathways edg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:edg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H7846_16785    00074 Mycolic acid biosynthesis     H7846_16785   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H7846_16785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding_2 PP-binding Motif Other DBs NCBI-ProteinID:  QNI36586 LinkDB All DBs Position complement(3987352..3987606) Genome browser AA seq 84 aa AA seqDB search MTQTEILAKMQTVFDDVFLDDVKVAPELSAKDVEEWDSLLQISLVLGVEKAFNVRFRVGE VEATKNLGEFADLIQRRMNEGAKA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacacaaactgaaatccttgccaaaatgcagactgtcttcgacgacgtgtttctagac gatgtgaaggtagcgcctgaactcagcgcgaaagatgtggaagagtgggactcgctgctg cagatctctcttgtgcttggtgtggaaaaggccttcaacgtgcggttccgcgtaggcgag gtggaagcaacgaagaacctcggagagtttgcggacctgattcagcgtcgtatgaacgaa ggcgcgaaggcctaa

DBGET integrated database retrieval system