Entamoeba dispar: EDI_099270 Help Entry EDI_099270        CDS       T01083                                  Name (RefSeq) RAC GTPase   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism edi  Entamoeba dispar Pathway edi04145   Phagosome edi04148   Efferocytosis edi04620   Toll-like receptor signaling pathway edi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:edi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EDI_099270    04148 Efferocytosis     EDI_099270  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     EDI_099270  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     EDI_099270  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:edi04131]     EDI_099270   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:edi04147]     EDI_099270    04031 GTP-binding proteins [BR:edi04031]     EDI_099270 Membrane trafficking [BR:edi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     EDI_099270  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     EDI_099270   Macropinocytosis    Ras GTPases     EDI_099270  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     EDI_099270 Exosome [BR:edi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EDI_099270   Exosomal proteins of other body fluids (saliva and urine)    EDI_099270   Exosomal proteins of colorectal cancer cells    EDI_099270   Exosomal proteins of bladder cancer cells    EDI_099270 GTP-binding proteins [BR:edi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     EDI_099270 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU EpCAM_N Motif Other DBs NCBI-GeneID:  5875637 NCBI-ProteinID:  XP_001740497 UniProt:  B0E7R8 LinkDB All DBs AA seq 195 aa AA seqDB search MQAVKCVIVGDGAVGKTCLLISYTTNAFPNEYIPTVFDNYSATVMVDSKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSVVSPPSFDNVSSKWQPEVSHHCPKTPCLLVGTKLDMR EDKEQLKRLEEKKITPITTEQGEAKCKDIGAVKYIECSALTQKNLRLVFDEAVRAVISPA GGAKKDKKKGGCMLF NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgcaagctgtcaaatgtgtcattgttggggatggagctgtaggaaaaacttgtctttta atttcttacactacaaatgcatttcctaacgaatatattccaacggtatttgataattat tctgccactgttatggtcgattctaaaccaattaatcttgggctttgggatactgctgga caagaagattatgatagattaagaccattatcatatccacaaactgatgtattcttaatt tgtttctcagttgtttctcctccatcatttgataacgtctcatctaagtggcaaccagaa gtttctcatcattgcccaaagactccatgtttattagttggaactaaacttgatatgaga gaagacaaggagcaattaaagagattagaagagaaaaaaattactccaatcactactgaa caaggtgaagctaaatgcaaagacattggagcagttaagtatatcgaatgttctgcttta actcaaaagaatttaagacttgtttttgatgaagctgttagggcagttatttctcctgca ggtggagcaaaaaaagataaaaagaaaggaggatgtatgctcttctaa

DBGET integrated database retrieval system