Edwardsiella sp. LADL05-105: AAZ33_17815 Help Entry AAZ33_17815       CDS       T04005                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism edl  Edwardsiella sp. LADL05-105 Brite KEGG Orthology (KO) [BR:edl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:edl03036]     AAZ33_17815 (zapB) Chromosome and associated proteins [BR:edl03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AAZ33_17815 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Leu_zip Seryl_tRNA_N PspA_IM30 DUF3450 Herpes_UL6 CtIP_N COG6_N DUF7491 YabA UPF0242 Nuf2_DHR10-like TMF_TATA_bd APG6_N FlaC_arch DUF7201 ERM_helical Sec10_N dCache_2 DUF4795 VPS51_Exo84_N DUF4763 XRCC4_CC NRBF2 DUF4407 Occludin_ELL Cnn_1N DUF2968 DUF5660 ADIP GrpE Motif Other DBs NCBI-ProteinID:  AKR79500 UniProt:  A0AAC8VDG0 LinkDB All DBs Position complement(4022392..4022634) Genome browser AA seq 80 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNQLNQEVQQAASNREGLLRENEQLKH EQGAWQERLRALLGKMDEVN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtatttgagaaactggaagcgaaagttcagcaggcgattgacaccatt accctgttgcagatggaaatcgaagagctgaaagagaaaaacaatcagcttaatcaagag gttcagcaggccgccagcaaccgtgaagggctgctgcgtgaaaatgagcagctgaagcat gagcagggggcatggcaggagcgcctgcgcgcgctgctgggaaaaatggatgaggtgaac tga

DBGET integrated database retrieval system