Edwardsiella sp. LADL05-105: AAZ33_17910 Help Entry AAZ33_17910       CDS       T04005                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism edl  Edwardsiella sp. LADL05-105 Brite KEGG Orthology (KO) [BR:edl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:edl03110]     AAZ33_17910 (grxC) Chaperones and folding catalysts [BR:edl03110]  Protein folding catalysts   Protein disulfide isomerase    AAZ33_17910 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_3 GST_N DUF7501 Motif Other DBs NCBI-ProteinID:  AKR79187 LinkDB All DBs Position complement(4040344..4040592) Genome browser AA seq 82 aa AA seqDB search MANVEIYTKATCPFCLRAKALLTAKGAGFDEIAIDANSEKREEMIARSGRTTVPQIFIDG RHIGGCDDLHALDARGELDPLL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccaacgttgaaatttataccaaagcgacctgcccattttgcctgcgcgccaaggcg ctgctgacggccaagggcgccgggtttgacgagatcgctatcgatgcaaactcggaaaag cgcgaggagatgatcgcgcgtagcggccgtactaccgtaccgcagatttttatcgacggg cgtcatattggtggctgtgatgacctgcacgcgctggatgcccgcggtgaacttgacccg ctgctgtaa

DBGET integrated database retrieval system