Enterococcus dispar: PML78_02090 Help Entry PML78_02090       CDS       T08868                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eds  Enterococcus dispar Pathway eds01100   Metabolic pathways eds01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eds00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PML78_02090    00074 Mycolic acid biosynthesis     PML78_02090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PML78_02090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  WCG33499 LinkDB All DBs Position complement(443766..443993) Genome browser AA seq 75 aa AA seqDB search MVFEKIQEIVAEELGKEKDEIQLTTNIQEDLEADSLDLFQIINEIEDEFDVKIETEEGIT TVADLVKYVEAQKAE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtatttgaaaaaattcaagaaatcgtagcagaagaattagggaaagaaaaagatgaa attcaattaacaactaatattcaagaagatttagaagcagatagtttggatttattccaa atcatcaatgaaatagaagatgagtttgatgtgaaaattgaaactgaagaaggcatcaca acagttgctgatcttgtaaaatatgttgaagcacaaaaagctgaataa

DBGET integrated database retrieval system