Enterococcus dispar: PML78_02525 Help Entry PML78_02525       CDS       T08868                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism eds  Enterococcus dispar Brite KEGG Orthology (KO) [BR:eds00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eds03032]     PML78_02525    03036 Chromosome and associated proteins [BR:eds03036]     PML78_02525    03400 DNA repair and recombination proteins [BR:eds03400]     PML78_02525 DNA replication proteins [BR:eds03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PML78_02525 Chromosome and associated proteins [BR:eds03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PML78_02525 DNA repair and recombination proteins [BR:eds03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PML78_02525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 Rpf1_C Glycos_trans_3N Ribosomal_L12 HU-DNA_bdg HU-CCDC81_euk_1 ArAE_2 Motif Other DBs NCBI-ProteinID:  WCG33582 LinkDB All DBs Position complement(536058..536333) Genome browser AA seq 91 aa AA seqDB search MANKAELIEKVAQATDLTKKDATAAVDAVFSTIQDALAKGEKVQLIGFGNFEVRSRAARK GRNPQTGDEIEIPASKVPAFKPGKALKDAVK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaaataaagctgaattgatcgaaaaagttgcacaagctactgacttaactaagaaa gacgctactgcagctgtagacgctgttttttcaacaatccaagatgctttagctaaaggt gaaaaagttcaattaatcggttttggtaacttcgaagttcgctctcgtgcggctcgtaaa ggacgtaacccacaaactggtgatgaaattgaaatccctgcaagcaaagtacctgcattc aaaccaggtaaagcattgaaagatgctgtgaaataa

DBGET integrated database retrieval system