Enterobacter dykesii: F0320_01655
Help
Entry
F0320_01655 CDS
T10162
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
edy Enterobacter dykesii
Pathway
edy02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
edy00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
F0320_01655 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
edy02000
]
F0320_01655 (phnC)
Enzymes [BR:
edy01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
F0320_01655 (phnC)
Transporters [BR:
edy02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
F0320_01655 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
SMC_N
RsgA_GTPase
AAA_16
NACHT
nSTAND1
Mg_chelatase
AAA_30
AAA_5
AAA_18
nSTAND3
AAA_28
AAA_25
AAA_22
MMR_HSR1
AAA_33
SbcC_Walker_B
AAA_19
Rad17
T2SSE
ORC-CDC6-like
PRK
AAA_13
AAA_24
TsaE
AAA_23
bpMoxR
Adeno_IVa2
G-alpha
cobW
AAA_7
Motif
Other DBs
NCBI-ProteinID:
XBN40152
UniProt:
A0AAU7J2D0
LinkDB
All DBs
Position
complement(358063..358851)
Genome browser
AA seq
262 aa
AA seq
DB search
MQTVIRVEKLSKTFNHNKALHAVDLTVQQGEMVALLGPSGSGKSTLLRHLSGLITCDKTP
ESHVELLGNTVQRAGRLASDIRKSRAQTGYIFQQFNLVNRLTVLENVLIGALGSTPFWRT
CLRWFSPSQKQEALQALTRVGMAHFAHQRVSTLSGGQQQRVAIARALMQKAQIILADEPI
ASLDPESARIVMETLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFFDGASHQF
DNERFDHLYRSINRVEENAQAA
NT seq
789 nt
NT seq
+upstream
nt +downstream
nt
atgcaaaccgtcatccgcgtcgagaaactgagcaagaccttcaatcacaataaggctctg
catgccgttgatctgaccgtccagcagggcgaaatggtggcgctgctggggccatccggt
tccggtaaatccacccttctgcgtcatttaagcggccttatcacctgcgataaaacgccg
gaaagccacgtcgagctgctgggcaataccgtgcaacgcgcgggccgtctcgccagcgat
atccgcaagagccgcgcccagacgggctatatcttccagcagttcaacctggtgaaccgc
ctgactgtgctggagaacgtgctgattggcgcgctcggcagcaccccgttctggcgcacc
tgtctgcgctggttctccccttcgcagaagcaggaagccttgcaggcgctgacccgcgtc
ggcatggcgcattttgcccaccagcgcgtctccaccctgtccggtggacaacagcagcgc
gtggcgattgcgcgtgcgctgatgcagaaagcgcaaattattctcgctgacgaacccatc
gcctcgctggacccggagtccgcccgcatcgtgatggaaaccctgcgcgacattaaccag
aacgacggcatcaccgtggtggtcacgctgcatcaggtggattacgccctgcgctactgc
gaacgcattgtcgccctgcgtcagggacacgtgttctttgatggcgcgagccatcagttt
gataacgaacgttttgaccatctctaccgcagcataaaccgcgtcgaagagaacgcgcag
gctgcttaa
DBGET
integrated database retrieval system