Enterobacter dykesii: F0320_07925 Help Entry F0320_07925       CDS       T10162                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism edy  Enterobacter dykesii Pathway edy01100   Metabolic pathways edy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:edy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F0320_07925 (acpP)    00074 Mycolic acid biosynthesis     F0320_07925 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F0320_07925 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  XBN41311 UniProt:  A0AAU7J5T5 LinkDB All DBs Position 1675633..1675869 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system