Enterobacter dykesii: F0320_20215 Help Entry F0320_20215       CDS       T10162                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism edy  Enterobacter dykesii Pathway edy01100   Metabolic pathways edy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:edy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F0320_20215    00074 Mycolic acid biosynthesis     F0320_20215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F0320_20215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XBN39580 UniProt:  A0AAU7J0E4 LinkDB All DBs Position 4221832..4222083 Genome browser AA seq 83 aa AA seqDB search MTEQETIYQEVCGLLTRLFEIDPQDITPEARLYEDLELDSIDAVDMIVHLQKKTGKKIKP ETFKSVRTVQDVVDAVEQLLREE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactgaacaagaaaccatttatcaggaagtctgcggccttctgaccaggctctttgaa atcgacccgcaggacattacgcccgaagcccgtctttatgaagacctggagctggacagc attgatgcggtggacatgatcgttcatctgcagaagaaaaccggtaagaaaatcaagccg gaaaccttcaaatcggttcgtaccgttcaggatgtggtagacgccgtcgaacagcttctg cgcgaagagtaa

DBGET integrated database retrieval system