Electrophorus electricus (electric eel): 113568716 Help Entry 113568716         CDS       T05787                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism eee  Electrophorus electricus (electric eel) Brite KEGG Orthology (KO) [BR:eee00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eee03036]     113568716   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113568716 Chromosome and associated proteins [BR:eee03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113568716 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113568716 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa TAF Motif Other DBs NCBI-GeneID:  113568716 NCBI-ProteinID:  XP_026852693 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MPEPAKSAPKKGSKKAVTKTDGKGGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMGI MNSFVNERIERIAGEASRLAHYKKRSTITSREALTFLIAFTNTV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcccgagcctgccaagtccgcgccgaagaagggatccaaaaaagccgtgactaagacg gacggtaaaggaggcaagaaacgcagaaagtcgaggaaggaaagttatgctatctacgtg tacaaagtcctgaaacaggtccaccccgacaccggtatctcttccaaggctatggggatc atgaattcctttgtgaatgagcgcatcgagcgcatcgctggtgaggcatctcgtctcgct cactacaagaagcgttcaaccatcacctccagggaggcccttaccttccttattgctttt actaatacagtgtaa

DBGET integrated database retrieval system