Electrophorus electricus (electric eel): 113569389 Help Entry 113569389         CDS       T05787                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism eee  Electrophorus electricus (electric eel) Pathway eee04060   Cytokine-cytokine receptor interaction eee04217   Necroptosis eee04620   Toll-like receptor signaling pathway eee04621   NOD-like receptor signaling pathway eee04622   RIG-I-like receptor signaling pathway eee04623   Cytosolic DNA-sensing pathway eee05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113569389  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     113569389  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113569389    04621 NOD-like receptor signaling pathway     113569389    04622 RIG-I-like receptor signaling pathway     113569389    04623 Cytosolic DNA-sensing pathway     113569389  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     113569389  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eee04052]     113569389 Cytokines and neuropeptides [BR:eee04052]  Cytokines   Interferons    113569389 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  113569389 NCBI-ProteinID:  XP_026853218 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search AANRDKDLKLTERDLAVAKAVYKTLTSIESLFDNYGIPQSWDGQKLEDFQNIVYRQIDES KCISGKTQKDEDDFSARDAAITDYFEKLKKLLKDMEFSDCAWETVRLEVLSLLQFIVVET SDNEFWSRRV NT seq 395 nt NT seq  +upstreamnt  +downstreamnt aagcggcgaatcgggataaagacctgaaactgaccgaaagggacttggcagttgcgaaag ctgtttataaaaccttaacgagcatagagtctctgttcgacaactacggcattccacagt cctgggacggtcaaaagcttgaagactttcaaaacattgtgtaccggcagatcgatgaga gcaaatgtatttcggggaaaacacaaaaggatgaagacgacttttctgcgagagacgctg ccataactgactattttgagaaactgaaaaaactcttgaaagacatggaattcagtgatt gcgcttgggagacggttcggcttgaggttctgagtcttctacagttcattgtggtggaga cttcagataacgagttctggtcacgaagagtctaa

DBGET integrated database retrieval system