Electrophorus electricus (electric eel): 113570179 Help Entry 113570179         CDS       T05787                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism eee  Electrophorus electricus (electric eel) Pathway eee03030   DNA replication eee03082   ATP-dependent chromatin remodeling eee03410   Base excision repair eee03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:eee00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     113570179 (pole3)    03410 Base excision repair     113570179 (pole3)    03420 Nucleotide excision repair     113570179 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113570179 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eee03032]     113570179 (pole3)    03036 Chromosome and associated proteins [BR:eee03036]     113570179 (pole3)    03400 DNA repair and recombination proteins [BR:eee03400]     113570179 (pole3) Enzymes [BR:eee01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      113570179 (pole3) DNA replication proteins [BR:eee03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     113570179 (pole3) Chromosome and associated proteins [BR:eee03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     113570179 (pole3) DNA repair and recombination proteins [BR:eee03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       113570179 (pole3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 DUF4746 PPP4R2 CIS_TMP Bromo_TP RNA_pol_3_Rpc31 ECM10 Motif Other DBs NCBI-GeneID:  113570179 NCBI-ProteinID:  XP_026854229 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPEGVNVSKEARRAISQAASVFVLYATSCANSFAMKAK RKTLNAGDVMAAMEEMEFERFLPPLREALEAYKKGQKGKKEASEQKRKDKEKKNGTENDK SREEEDDEEEHMEDELDADNEGEEEDVEN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagagaccagaggaccttaaccttccgaatgctgtcatcacacgcattattaaa gaggctctgccggaaggggtaaatgtatccaaagaggcaagaagggcaatatctcaagca gccagtgtatttgttctatacgcaacatcatgtgccaacagctttgccatgaaagccaag agaaagactctcaatgccggagatgtgatggcggctatggaagagatggagtttgagcgt ttcttaccacccctgcgtgaagctcttgaggcctacaagaaagggcagaaaggcaaaaaa gaggcatcagagcaaaaaaggaaggacaaagagaagaagaatggcacagagaatgacaaa agccgtgaggaagaggatgatgaagaagagcacatggaagatgagctggatgcagacaac gaaggagaggaggaggatgtggagaactga

DBGET integrated database retrieval system