Electrophorus electricus (electric eel): 113570704 Help Entry 113570704         CDS       T05787                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism eee  Electrophorus electricus (electric eel) Pathway eee04068   FoxO signaling pathway eee04136   Autophagy - other eee04140   Autophagy - animal eee04621   NOD-like receptor signaling pathway eee04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     113570704 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113570704 (atg12)    04136 Autophagy - other     113570704 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     113570704 (atg12)    04622 RIG-I-like receptor signaling pathway     113570704 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113570704 (atg12)    04121 Ubiquitin system [BR:eee04121]     113570704 (atg12)    03029 Mitochondrial biogenesis [BR:eee03029]     113570704 (atg12) Membrane trafficking [BR:eee04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     113570704 (atg12) Ubiquitin system [BR:eee04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    113570704 (atg12) Mitochondrial biogenesis [BR:eee03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     113570704 (atg12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  113570704 NCBI-ProteinID:  XP_026855076 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MSDNAEAPTEIHKYESSAQQSVTDTGDTGSTGEKKKIDVLLKAVGDTPIMKTKKWAVERG RTVQSLSQFISRFLKLEPNEQLFIYVNQSFAPSPDQEVGVLFECFGSDGKLVLHYCKSQA WG NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagaagctcccacagaaatacacaaatatgagtcctcggcacaacag agcgttactgatacaggagatactggatcgacaggagagaagaaaaagattgacgtgctc ttgaaggcggtcggagacacccccataatgaagacaaagaagtgggcggtggagagaggg aggaccgtgcagtcactctctcagtttatctcacgctttcttaaacttgagcctaacgaa caactgttcatttacgtgaatcagtcatttgccccgtcaccggatcaagaagtgggtgtg ctttttgaatgttttggcagtgacgggaaacttgttctacattattgcaaatcacaagcc tggggataa

DBGET integrated database retrieval system