Electrophorus electricus (electric eel): 113571522 Help Entry 113571522         CDS       T05787                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism eee  Electrophorus electricus (electric eel) Pathway eee03030   DNA replication eee03410   Base excision repair eee03420   Nucleotide excision repair eee03430   Mismatch repair eee03440   Homologous recombination Brite KEGG Orthology (KO) [BR:eee00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     113571522 (pold4)    03410 Base excision repair     113571522 (pold4)    03420 Nucleotide excision repair     113571522 (pold4)    03430 Mismatch repair     113571522 (pold4)    03440 Homologous recombination     113571522 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eee03032]     113571522 (pold4)    03400 DNA repair and recombination proteins [BR:eee03400]     113571522 (pold4) DNA replication proteins [BR:eee03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     113571522 (pold4) DNA repair and recombination proteins [BR:eee03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       113571522 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      113571522 (pold4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  113571522 NCBI-ProteinID:  XP_026856307 UniProt:  A0A4W4E4X1 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MTAKRGLITDTFKVVKKTKREDRRDKKPPPPPTADPEPPCLSERETDLQDLKDFDLDWRF GPCTGISRMKRWERAALHMLNPPQMIKDILLKESTDPDYSESLWHSYPL NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgacagcaaaacgaggcctcatcactgacacgttcaaggtagtgaagaagacaaaaaga gaggacagaagggacaaaaaacctcctccacctcccactgcagatccagaacctccttgc ctgagtgaaagagaaactgatctgcaagacctgaaagactttgacctggactggcgcttt gggccctgcacagggatcagtcggatgaagaggtgggagagggcagctctgcatatgctg aaccccccacagatgattaaagacattttactgaaggagagcacagacccagactactca gagagcctctggcatagctatcccttgtaa

DBGET integrated database retrieval system