Electrophorus electricus (electric eel): 113572358 Help Entry 113572358         CDS       T05787                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism eee  Electrophorus electricus (electric eel) Pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04144   Endocytosis eee04145   Phagosome eee04148   Efferocytosis eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113572358    04145 Phagosome     113572358    04140 Autophagy - animal     113572358    04137 Mitophagy - animal     113572358    04148 Efferocytosis     113572358  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113572358  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113572358   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113572358    04031 GTP-binding proteins [BR:eee04031]     113572358 Membrane trafficking [BR:eee04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113572358 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113572358   Exosomal proteins of other body fluids (saliva and urine)    113572358   Exosomal proteins of colorectal cancer cells    113572358   Exosomal proteins of bladder cancer cells    113572358 GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113572358 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_7 AAA_16 AAA_5 NTPase_1 IIGP AAA_24 nSTAND3 AAA_29 nSTAND1 FeoB_N AAA_22 TniB Motif Other DBs NCBI-GeneID:  113572358 NCBI-ProteinID:  XP_026857630 UniProt:  A0A4W4FEG8 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MMAEWSKSHLKVVLVGNSGVGKSSIMTRFVDHRFTNMYRATIGVDFLTKEMTVDQSPVVF QIWDTAGTERFHSLGTSLYCRAHCCLLVFDVTSAASFSALDGWKKEFLAQSCPTEPASFP FIVLGNKTDLDVREVSMNRAQLWCEAVGAQYFECSAKEGTAIDAAFEVAAKAALHYFRSN AMDHREEVKITSKQETNSKQSEVLRSPQCNC NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgatggcagagtggagtaaatcccatctgaaagtggttctggtaggaaactctggtgtg ggaaaatcttcaattatgactcgatttgtggaccatcgatttactaacatgtatcgtgct accattggggtggatttcctgactaaagagatgactgtggaccaaagcccagtggtcttt cagatctgggacaccgctggcacagagaggttccactcgttgggcacttccctgtactgc agggctcactgctgccttctagtgtttgatgtgacctcagcagcttcttttagtgctctg gacggctggaagaaggagttccttgcacagtcatgccccaccgaacctgcaagtttcccc ttcatagtccttggcaataagactgacctggatgtccgagaggtttcaatgaaccgtgca cagctgtggtgcgaggctgtgggagcgcagtattttgagtgcagtgctaaggaaggcaca gcaattgacgcagcgttcgaagttgcagccaaagctgctctgcactattttagatctaat gctatggatcatagagaagaagtcaaaataaccagcaagcaagaaacaaacagcaaacag tcagaagtcctgcgaagtccccagtgtaactgctga

DBGET integrated database retrieval system