Electrophorus electricus (electric eel): 113572575 Help Entry 113572575         CDS       T05787                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism eee  Electrophorus electricus (electric eel) Pathway eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113572575  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113572575    04990 Domain-containing proteins not elsewhere classified [BR:eee04990]     113572575 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of microglial cells    113572575 Domain-containing proteins not elsewhere classified [BR:eee04990]  EF-hand domain-containing proteins   S100 proteins    113572575 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg DEK_C Motif Other DBs NCBI-GeneID:  113572575 NCBI-ProteinID:  XP_026858061 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSDLEKAMESLIMVFHRYACREGNSNTLSRRELRELMENELSNFLKSQKDPGIVDKIMK DLDTNRDGEVSFEEFVSLVVGLSIACEQCYQVHLKKTGARK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccctcggacctggaaaaggccatggagtccctcattatggtgttccaccgctatgcc tgcagagaggggaacagcaacaccctgagtcgcagagaactccgcgagctgatggaaaac gagctctccaacttcctcaaatctcagaaggatcctggtatagtggacaagatcatgaag gacctggacacaaaccgagatggagaagtgagctttgaggagtttgtatctttagtggta gggctgtccattgcctgcgaacagtgttatcaggtgcacctgaagaagacgggagcccga aaataa

DBGET integrated database retrieval system