Electrophorus electricus (electric eel): 113576002 Help Entry 113576002         CDS       T05787                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism eee  Electrophorus electricus (electric eel) Pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04144   Endocytosis eee04145   Phagosome eee04148   Efferocytosis eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113576002 (rab7a)    04145 Phagosome     113576002 (rab7a)    04140 Autophagy - animal     113576002 (rab7a)    04137 Mitophagy - animal     113576002 (rab7a)    04148 Efferocytosis     113576002 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113576002 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113576002 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113576002 (rab7a)    04031 GTP-binding proteins [BR:eee04031]     113576002 (rab7a) Membrane trafficking [BR:eee04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113576002 (rab7a) Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113576002 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    113576002 (rab7a)   Exosomal proteins of colorectal cancer cells    113576002 (rab7a)   Exosomal proteins of bladder cancer cells    113576002 (rab7a) GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113576002 (rab7a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 PduV-EutP nSTAND3 NTPase_1 cobW Septin AAA_7 AAA_22 AAA_16 AAA_24 AAA_5 ATPase_2 NB-ARC NACHT AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  113576002 NCBI-ProteinID:  XP_026863686 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSSQYKATIGADFLTKEVMVEDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPTTFKTLDSWRDEFLIQASPRDPDSFPF VALGNKIDMENRQVTTKRAQAWCQSKSNMPYFETSAKEAINVEQAFKTIASNALKKETEV ELYNEFPEPIKLDRSDRSNPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatctaggaagaaagttcttcttaaagtcatcatccttggagattcaggtgttgga aagacatctttaatgaaccaatatgttaacaagaaattcagcagtcagtataaagctaca ataggagctgactttctcacaaaggaggtgatggttgaggatagacttgttactatgcag atttgggacacagcagggcaagaaaggttccagtccctgggggtggcattctatcgcggt gctgactgctgtgttctggtgtttgatgttactgctcccaccacctttaaaactctggac tcctggcgagatgagtttctgattcaggctagtccccgtgatccagacagcttccctttt gtggcacttggcaacaagattgacatggaaaacaggcaggtgacaacaaaacgagctcag gcctggtgtcagagtaaaagcaacatgccatactttgagaccagcgcaaaagaggccata aatgttgaacaagcatttaaaaccattgcaagcaatgccctaaaaaaggaaacagaagta gagttgtataatgagtttccagagccaattaagttggacagaagtgatagatccaaccca tcagcagaaagctgcagttgctga

DBGET integrated database retrieval system