Electrophorus electricus (electric eel): 113576570 Help Entry 113576570         CDS       T05787                                  Symbol dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism eee  Electrophorus electricus (electric eel) Pathway eee04814   Motor proteins eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     113576570 (dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113576570 (dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:eee03037]     113576570 (dynlt1)    04812 Cytoskeleton proteins [BR:eee04812]     113576570 (dynlt1) Cilium and associated proteins [BR:eee03037]  Motile cilia and associated proteins   Dynein arm    113576570 (dynlt1) Cytoskeleton proteins [BR:eee04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      113576570 (dynlt1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 Motif Other DBs NCBI-GeneID:  113576570 NCBI-ProteinID:  XP_026864533 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDDFQTGEETAFVVDEVSTIVKEAVEGAIGGNAYQHNRVNQWTNNVVEQCLTQLSKLGKP FKYIVTCIIMQKNGAGLQTACSCFWDNTTDGSCTVRWENKSMYCIVSVFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgattttcagactggagaagagacagcctttgtcgtggacgaagtgagtactata gttaaggaggcagttgaaggagcgattggtggtaatgcgtatcagcacaacagggtgaac cagtggacgaataatgtggtggagcaatgtcttactcaactcagcaaactaggaaaaccg ttcaagtatatcgtaacctgcattatcatgcagaagaatggagctggtttgcagacagct tgttcatgtttctgggacaacaccacagatgggagttgcactgtgaggtgggaaaacaag tcaatgtactgcattgtcagtgtctttgggctctccatttaa

DBGET integrated database retrieval system