Electrophorus electricus (electric eel): 113576879 Help Entry 113576879         CDS       T05787                                  Name (RefSeq) elongin-B-like isoform X1   KO K03873   elongin-B Organism eee  Electrophorus electricus (electric eel) Pathway eee04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:eee00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113576879  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:eee04121]     113576879    03400 DNA repair and recombination proteins [BR:eee03400]     113576879 Ubiquitin system [BR:eee04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113576879    Cul5 complex      113576879 DNA repair and recombination proteins [BR:eee03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113576879 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  113576879 NCBI-ProteinID:  XP_026865021 UniProt:  A0AAY5EU52 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTSVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLALRISDDAFELLHVEPFSNPPELPDVMKPQDSGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattcggcgtcacaagacgaccatcttcactgacgctaaagag tctaccagtgtgtatgagttgaagcgcattgttgagggaattctgaagagacctcctgaa gaccagaggctttataaggatgaccagctgctagaagacagtaaaacactgggagactgt ggctttaccaaccagacagccagaccacaggctcctgctactgtaggacttgccttgcgc atcagtgacgatgcattcgagctgctgcatgtggagcccttctctaaccctccagagctc cctgatgtcatgaagccccaggactctggcagcacagccaatgagcagtctgtgcagtaa

DBGET integrated database retrieval system