Electrophorus electricus (electric eel): 113577375 Help Entry 113577375         CDS       T05787                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism eee  Electrophorus electricus (electric eel) Pathway eee04010   MAPK signaling pathway eee04012   ErbB signaling pathway eee04068   FoxO signaling pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04150   mTOR signaling pathway eee04210   Apoptosis eee04218   Cellular senescence eee04370   VEGF signaling pathway eee04371   Apelin signaling pathway eee04540   Gap junction eee04625   C-type lectin receptor signaling pathway eee04810   Regulation of actin cytoskeleton eee04910   Insulin signaling pathway eee04912   GnRH signaling pathway eee04916   Melanogenesis Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113577375 (nras)    04012 ErbB signaling pathway     113577375 (nras)    04370 VEGF signaling pathway     113577375 (nras)    04371 Apelin signaling pathway     113577375 (nras)    04068 FoxO signaling pathway     113577375 (nras)    04150 mTOR signaling pathway     113577375 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113577375 (nras)    04137 Mitophagy - animal     113577375 (nras)   09143 Cell growth and death    04210 Apoptosis     113577375 (nras)    04218 Cellular senescence     113577375 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     113577375 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113577375 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113577375 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     113577375 (nras)    04912 GnRH signaling pathway     113577375 (nras)    04916 Melanogenesis     113577375 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113577375 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113577375 (nras)    04031 GTP-binding proteins [BR:eee04031]     113577375 (nras) Membrane trafficking [BR:eee04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113577375 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     113577375 (nras) Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113577375 (nras)   Exosomal proteins of other body fluids (saliva and urine)    113577375 (nras)   Exosomal proteins of breast cancer cells    113577375 (nras)   Exosomal proteins of colorectal cancer cells    113577375 (nras) GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113577375 (nras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  113577375 NCBI-ProteinID:  XP_026865788 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHHRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagttggtggttgtaggggctggtggtgtggggaagagtgcactcacc atacagctcatccagaatcactttgtggatgaatatgaccccaccatagaggactcgtac aggaaacaagtggtgattgacggggagacatgtctcctggacatcctggacacagctgga caggaggagtacagtgccatgagagatcagtacatgaggacgggcgagggcttcctctgc gtctttgccatcaacaacaccaagtccttcgctgatgtacatttatatcgcgagcagatc aagcgagtgaaagactctgatgatgttcccatggtgctggttggaaacaaatgtgatttg gccaggaccgtcgacaccaagcaggctcaggagctggccaggagctatggcatagaattt gtagaaacctcagccaagaccagacagggagttgaggatgccttttacacccttgtccgt gagatccgccatcatcgcatgaaaaaactcaacagcagggaggacaggaaacagggttgc cttggtgtctcctgtgaagtcatgtga

DBGET integrated database retrieval system