Electrophorus electricus (electric eel): 113578160 Help Entry 113578160         CDS       T05787                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism eee  Electrophorus electricus (electric eel) Pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04144   Endocytosis eee04145   Phagosome eee04148   Efferocytosis eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113578160    04145 Phagosome     113578160    04140 Autophagy - animal     113578160    04137 Mitophagy - animal     113578160    04148 Efferocytosis     113578160  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113578160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113578160   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113578160    04031 GTP-binding proteins [BR:eee04031]     113578160 Membrane trafficking [BR:eee04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113578160 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113578160   Exosomal proteins of other body fluids (saliva and urine)    113578160   Exosomal proteins of colorectal cancer cells    113578160   Exosomal proteins of bladder cancer cells    113578160 GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113578160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 PduV-EutP nSTAND3 AAA_16 Septin AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha ATPase_2 AAA_5 AAA_14 ATP-synt_ab NACHT DAP3 MCM Motif Other DBs NCBI-GeneID:  113578160 NCBI-ProteinID:  XP_026867045 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQESEG EPYDFPDQIKLRDDRPASSSEGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacctctcgcaaaaaggtgctgctcaaagtcatcatactcggggactccggggttggg aagacctctttaatgaaccagtatgttaacaacaagttcagcaaccagtataaggccacg attggtgcagatttcctgaccaaggaggttatggtcgatgacaggcttgttaccatgcag atttgggatacagctggacaggagcgtttccagtctctgggtgtggccttctacagaggg gcagactgctgcgtgctggtgtacgacgtcacggccccgaacaccttcaagaccctggac agctggagggacgagttcctgatccaggccagccctcgcgaccctgaaaacttccctttc gtggtgcttggcaacaagatcgacttggagaacagacaggttacaacaaaacgggctcaa gcgtggtgtcaaagcaagaacaacatcccttatttcgagaccagtgccaaagaagctatc aatgtggaccaggctttccagacaattgctcgaaatgcacttaaacaggagtctgagggg gagccctacgacttccccgaccagatcaagctaagagacgacagacctgcctcctcgagt gaaggctgtagctgctga

DBGET integrated database retrieval system