Electrophorus electricus (electric eel): 113578254 Help Entry 113578254         CDS       T05787                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism eee  Electrophorus electricus (electric eel) Pathway eee04814   Motor proteins eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     113578254 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113578254 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:eee03037]     113578254 (dynlt3)    04812 Cytoskeleton proteins [BR:eee04812]     113578254 (dynlt3) Cilium and associated proteins [BR:eee03037]  Motile cilia and associated proteins   Dynein arm    113578254 (dynlt3) Cytoskeleton proteins [BR:eee04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      113578254 (dynlt3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  113578254 NCBI-ProteinID:  XP_026867206 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MEEYHSGDEVAFSPDEASNAVKECIEGVIGGVDYNQNNVNQWTARIVEHSLTQLVKQGKP FKYIVNCAVMQKSGAGLHTANSCYWDTTTDGSCTVRWENRTMYCVVGVFAVAIAL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccattctggagatgaggtggccttcagtccagatgaagccagtaatgct gttaaagagtgcattgaaggtgttataggtggtgtggactacaaccagaataatgtaaac cagtggacagctagaatagtggagcattcactcactcagctggtgaaacaggggaaacca tttaagtacattgtgaactgtgctgtaatgcagaagagtggcgctggtcttcacacagca aactcctgctactgggacactaccactgatggaagctgcacagtcagatgggagaaccgc accatgtattgtgtcgttggcgtgtttgccgtcgctattgctctctaa

DBGET integrated database retrieval system