Electrophorus electricus (electric eel): 113578896 Help Entry 113578896         CDS       T05787                                  Symbol brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism eee  Electrophorus electricus (electric eel) Pathway eee04810   Regulation of actin cytoskeleton eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113578896 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113578896 (brk1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  113578896 NCBI-ProteinID:  XP_026868228 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctgggcaggaggatccagttcaaagggaaattcaccaggactgggcgaatcgggaa tacatcgaagtgattactagcagcatcaagaaaatagccgatttccttaattcgtttgat atgtcctgcaggtcccgtttagctaccttgaatgagaagctaactgccctagagaggagg attgagtacattgaagccagagttacaaaaggggaaacgctcacctaa

DBGET integrated database retrieval system