Electrophorus electricus (electric eel): 113579694 Help Entry 113579694         CDS       T05787                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism eee  Electrophorus electricus (electric eel) Pathway eee04010   MAPK signaling pathway eee04012   ErbB signaling pathway eee04068   FoxO signaling pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04144   Endocytosis eee04150   mTOR signaling pathway eee04210   Apoptosis eee04218   Cellular senescence eee04370   VEGF signaling pathway eee04371   Apelin signaling pathway eee04510   Focal adhesion eee04540   Gap junction eee04625   C-type lectin receptor signaling pathway eee04810   Regulation of actin cytoskeleton eee04910   Insulin signaling pathway eee04912   GnRH signaling pathway eee04916   Melanogenesis eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113579694    04012 ErbB signaling pathway     113579694    04370 VEGF signaling pathway     113579694    04371 Apelin signaling pathway     113579694    04068 FoxO signaling pathway     113579694    04150 mTOR signaling pathway     113579694  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113579694    04140 Autophagy - animal     113579694    04137 Mitophagy - animal     113579694   09143 Cell growth and death    04210 Apoptosis     113579694    04218 Cellular senescence     113579694   09144 Cellular community - eukaryotes    04510 Focal adhesion     113579694    04540 Gap junction     113579694   09142 Cell motility    04810 Regulation of actin cytoskeleton     113579694  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113579694   09152 Endocrine system    04910 Insulin signaling pathway     113579694    04912 GnRH signaling pathway     113579694    04916 Melanogenesis     113579694  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113579694  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113579694   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113579694    04031 GTP-binding proteins [BR:eee04031]     113579694 Membrane trafficking [BR:eee04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113579694  Endocytosis   Macropinocytosis    Ras GTPases     113579694 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113579694   Exosomal proteins of colorectal cancer cells    113579694 GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113579694 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  113579694 NCBI-ProteinID:  XP_026869620 UniProt:  A0A4W4GWK2 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaaactagtggtggttggcgctggaggtgtgggcaaaagtgccctcacc atccaacttatccagaaccactttgttgatgagtatgaccctactattgaagactcctac aggaagcaagtggtgatcgatggggagacatgtctcctggacatattggacacagctgga caggaggagtacagtgcaatgagagaccagtacatgaggacgggagagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaagacatccaccagtacagggaacagatc aaaagggtgaaagactctgatgacgtgcccatggtgcttgtgggtaataaatgtgacctc cctgcacgtacggtggacaccaggcaagctcaagaattggctcggagttatggcatccct tatattgaaacatctgccaagacgagacagggagtggaggatgctttttacacacttgtc cgtgaaatcagacagcataagctgaggaagctgaatccaccagatgacaacggccaagat tgcatgaactgccgatgtgtggtgtcatga

DBGET integrated database retrieval system