Electrophorus electricus (electric eel): 113580274 Help Entry 113580274         CDS       T05787                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism eee  Electrophorus electricus (electric eel) Pathway eee04010   MAPK signaling pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04218   Cellular senescence eee04371   Apelin signaling pathway eee04519   Cadherin signaling eee04625   C-type lectin receptor signaling pathway eee04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113580274 (rras)    04371 Apelin signaling pathway     113580274 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     113580274 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113580274 (rras)    04137 Mitophagy - animal     113580274 (rras)   09143 Cell growth and death    04218 Cellular senescence     113580274 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113580274 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113580274 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113580274 (rras)    04031 GTP-binding proteins [BR:eee04031]     113580274 (rras) Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113580274 (rras)   Exosomal proteins of bladder cancer cells    113580274 (rras) GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113580274 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 ATP_bind_1 DUF192 Motif Other DBs NCBI-GeneID:  113580274 NCBI-ProteinID:  XP_026870519 UniProt:  A0A4W4GB68 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSSEGERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDGGSYNEIQKFHTQILRVKDRDDFPMVLVGN KSDLDQHRVVSKEEAMAFARENRIHYMESSAKNRHNVDEAFLEVVRAIRKFQETESPPQL ANHARKQKSGGCPCTIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcagagggggaaagatacaaactggtggtcgtaggcggtggtggtgtggggaag agtgccctaaccattcagttcattcagtcatactttgtatctgactatgacccaaccatt gaggactcttacaccaaaatctgcactgtggatgggaaagaaacacgattagacattttg gatacagcaggtcaagaagagtttggagctatgagagaacagtatatgcgttcaggagag ggattcttgctggtctttgctctgaatgatggcggaagttacaatgaaatccagaagttt cacacacagattctgcgggtaaaggacagagacgacttccccatggtgctcgttggtaac aaatctgatctggaccaacacagagtggtttccaaagaagaggccatggcattcgctaga gagaaccggatccactatatggagtcatcagcaaagaaccgccacaatgtggatgaagct tttctggaagtggtgcgagcaataagaaagtttcaggaaacggagagtcccccgcagctc gcaaatcatgctaggaagcagaagagtggtggctgtccctgcactattctctga

DBGET integrated database retrieval system