Electrophorus electricus (electric eel): 113580833 Help Entry 113580833         CDS       T05787                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism eee  Electrophorus electricus (electric eel) Pathway eee04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:eee00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113580833  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:eee04121]     113580833    03400 DNA repair and recombination proteins [BR:eee03400]     113580833 Ubiquitin system [BR:eee04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113580833    Cul5 complex      113580833 DNA repair and recombination proteins [BR:eee03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113580833 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  113580833 NCBI-ProteinID:  XP_026871446 UniProt:  A0AAY5EM94 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPATVGLAFRISDDAFEPLRVEPFSSPPELPDVMKPQDSGSTASEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttttgatgatccgacgtcacaagacgaccatcttcacagatgccaaggag tcgaccacagtgtatgagctgaagcgcatcgtggagggcattttaaagcggcccccggag gatcagagactctacaaggatgacatgttgctagaagacagcaagacccttggagattgt ggattcacaaaccagacagcaagacctcaggctccagccacagtaggcctggcctttcgc atcagtgatgatgcttttgagccgttgcgagtggaacctttctcaagtcctcctgagctc cctgatgtcatgaagccccaggactctggcagcactgccagcgaacaggctgtgcagtga

DBGET integrated database retrieval system