Electrophorus electricus (electric eel): 113581239 Help Entry 113581239         CDS       T05787                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism eee  Electrophorus electricus (electric eel) Brite KEGG Orthology (KO) [BR:eee00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:eee01002]     113581239   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113581239 Peptidases and inhibitors [BR:eee01002]  Peptidase inhibitors   Family I25: cystatin family    113581239 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113581239 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  113581239 NCBI-ProteinID:  XP_026872043 UniProt:  A0A4W4GT72 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MPLLCGGTSEAKDADDKIQELCDKVKLQAEAKAGKAFDVFSAKSYKTQIVAGTNYFIKVH VGGEEYIHLRVFEMLPHAGSTLHVHGVQTPKAHHDPIEYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcctttattgtgtggcgggacctctgaggcgaaggatgcagatgataaaattcaggaa ctctgtgacaaagtgaagcttcaagcagaggcgaaggcaggcaaagcatttgatgttttc agcgcaaaatcttacaagacacagatagtagctgggactaattatttcatcaaggtccat gtagggggtgaagagtacattcacctgcgtgtttttgagatgctgcctcacgcaggaagt accctacacgtgcacggtgtgcagacacccaaagcccaccatgaccctattgaatacttc tga

DBGET integrated database retrieval system