Electrophorus electricus (electric eel): 113581478 Help Entry 113581478         CDS       T05787                                  Name (RefSeq) ras-related protein M-Ras-like   KO K07831   Ras-related protein M-Ras Organism eee  Electrophorus electricus (electric eel) Pathway eee04010   MAPK signaling pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04218   Cellular senescence eee04371   Apelin signaling pathway eee04625   C-type lectin receptor signaling pathway eee04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113581478    04371 Apelin signaling pathway     113581478  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113581478    04137 Mitophagy - animal     113581478   09143 Cell growth and death    04218 Cellular senescence     113581478   09142 Cell motility    04810 Regulation of actin cytoskeleton     113581478  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113581478  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:eee04031]     113581478 GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113581478 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc DUF3499 GTP_EFTU Arf MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  113581478 NCBI-ProteinID:  XP_026872449 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MREQYMRTGDGFLIVFSVTDKASFAHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKI TSEQGWEMAMKHSITYIETSAKDPPMNVDKAFHELVRVIRQQIPEKSQKKKKSRWRADRR SGSARAHCVLF NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgagagagcagtacatgcgcacgggagatggcttcctcatcgtgttctctgtgacagac aaagccagcttcgcacacgtggaccgctttcatcagctcatcctgagggttaaggacagg gagtcctttcccatggtcctggttgctaataaggtggatctggtgcatttacggaagatc acaagtgagcagggatgggagatggccatgaagcacagtattacatacatagaaacaagt gccaaggatccacccatgaatgtggataaagcatttcatgagcttgtgagagtgattcgg cagcagattccagaaaagagccagaagaagaagaagagcagatggagggcagacaggcgc tcaggctcagccagggctcactgtgtcttgttctga

DBGET integrated database retrieval system