Electrophorus electricus (electric eel): 113582797 Help Entry 113582797         CDS       T05787                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism eee  Electrophorus electricus (electric eel) Pathway eee04081   Hormone signaling eee04144   Endocytosis eee04150   mTOR signaling pathway eee04270   Vascular smooth muscle contraction eee04310   Wnt signaling pathway eee04350   TGF-beta signaling pathway eee04510   Focal adhesion eee04517   IgSF CAM signaling eee04519   Cadherin signaling eee04520   Adherens junction eee04530   Tight junction eee04621   NOD-like receptor signaling pathway eee04625   C-type lectin receptor signaling pathway eee04810   Regulation of actin cytoskeleton eee05100   Bacterial invasion of epithelial cells eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     113582797    04350 TGF-beta signaling pathway     113582797    04150 mTOR signaling pathway     113582797   09133 Signaling molecules and interaction    04081 Hormone signaling     113582797    04517 IgSF CAM signaling     113582797    04519 Cadherin signaling     113582797  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113582797   09144 Cellular community - eukaryotes    04510 Focal adhesion     113582797    04520 Adherens junction     113582797    04530 Tight junction     113582797   09142 Cell motility    04810 Regulation of actin cytoskeleton     113582797  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     113582797    04625 C-type lectin receptor signaling pathway     113582797   09153 Circulatory system    04270 Vascular smooth muscle contraction     113582797  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113582797    05100 Bacterial invasion of epithelial cells     113582797  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113582797   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113582797    04031 GTP-binding proteins [BR:eee04031]     113582797 Membrane trafficking [BR:eee04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     113582797 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113582797   Exosomal proteins of other body fluids (saliva and urine)    113582797   Exosomal proteins of colorectal cancer cells    113582797   Exosomal proteins of bladder cancer cells    113582797 GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     113582797 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  113582797 NCBI-ProteinID:  XP_026874568 UniProt:  A0AAY5EEX8 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKPEEGRDMANRIYAFGYMECSAKTKDGVRDVFEMATRAALQ ARKGKKGTKCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatccgtaaaaaactggtcatagttggcgacggagcgtgtggaaagacgtgt cttctaatcgtcttcagtaaggaccagtttcccgaggtctacgtgcccacagtgtttgaa aactacgtagctgacatcgaggttgacagcaaacaagttgagctcgccctgtgggacaca gccggtcaggaggactacgatcggctccggccgctctcctacccagatacggatgtcatc ctgatgtgcttctctatcgatagcccagacagtcttgagaacattccagagaaatggact ccagaggtgaagcacttctgccccaacgttcccatcatcctggtgggcaacaaaaaggac ctgcgtaacgacgaccacacccgccgtgagctggccaagatgaagcaggagccagtcaag ccagaggaaggcagagatatggccaaccgaatctatgccttcggatacatggagtgctct gccaagacaaaggatggcgtgagggatgtatttgaaatggccaccagggctgcgctgcag gccagaaagggcaagaaaggcactaaatgcctcatactgtaa

DBGET integrated database retrieval system