Electrophorus electricus (electric eel): 113582881 Help Entry 113582881         CDS       T05787                                  Symbol rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism eee  Electrophorus electricus (electric eel) Pathway eee04140   Autophagy - animal eee04144   Endocytosis eee04530   Tight junction Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113582881 (rab8a)    04140 Autophagy - animal     113582881 (rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     113582881 (rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113582881 (rab8a)    03036 Chromosome and associated proteins [BR:eee03036]     113582881 (rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113582881 (rab8a)    04031 GTP-binding proteins [BR:eee04031]     113582881 (rab8a) Membrane trafficking [BR:eee04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     113582881 (rab8a)  Autophagy   Other autophagy associated proteins     113582881 (rab8a) Chromosome and associated proteins [BR:eee03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     113582881 (rab8a) Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113582881 (rab8a)   Exosomal proteins of other body fluids (saliva and urine)    113582881 (rab8a)   Exosomal proteins of colorectal cancer cells    113582881 (rab8a) GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     113582881 (rab8a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 Septin DUF3963 Tor_FN3_2nd AAA_7 Motif Other DBs NCBI-GeneID:  113582881 NCBI-ProteinID:  XP_026874706 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILG NKCDINDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGN NPQGSNHGVKITTEPQRKSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacttacgattatttgtttaaactgctgttaatcggggactccggagttgga aagacctgtgtattgttcaggttctccgaggatgcctttaactcaacctttatctccacg ataggtattgatttcaagattaggacaatagagttagatggcaagaagatcaagttgcag atatgggacacagcagggcaggaacgattccggacgatcacaacggcgtattataggggt gcaatgggcattatgctggtatatgacatcaccaatgagaagtcgtttgacaacatcaag aactggattaggaatattgaggagcatgcatcggcagatgtagagaagatgattctaggg aataaatgtgatatcaacgacaagcgacaggtgtccaaagagagaggagagaagttggca ttagagtatggcatcaagtttatggagacgagcgcgaaggccaacatcaacgttgagaac gcattcttaacacttgccagagacatcaaagcaaagatggacacaaaattggagggcaac aacccccagggcagcaaccatggagtgaagatcaccacagagccgcagagaaagagcagc ttcttccgttgtgtcctattgtga

DBGET integrated database retrieval system